.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gt7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Signal Receiver Domain of Signal Transduction Kinase from Syntrophus Aciditrophicus. To be Published
    Site NYSGXRC
    PDB Id 3gt7 Target Id NYSGXRC-11024a
    Molecular Characteristics
    Source Syntrophus aciditrophicus
    Alias Ids TPS27042,3.40.50.2300, Q2LQE8_SYNAS, PF00072 Molecular Weight 81168.11 Da.
    Residues 725 Isoelectric Point 5.83
    Sequence mkvtgtvsnrageilivedsptqaehlkhileetgyqtehvrngreavrflsltrpdliisdvlmpemd gyalcrwlkgqpdlrtipvilltilsdprdvvrslecgaddfitkpckdvvlashvkrllsgvkrteer ysresitlafgnssyhitadlhktanlllssyetaieknrdliaaqqelrilneclehrveartaelra eiarreaaeqtlrqseqqlqhilnhihtgflvinaqtkrivevnasaaemiglpretilgecccrfifp dlsgcpiefpervgsqsehllrtasgnllpilrtasimtlhgqphivesfvnisaqkqaeeerlalekq lfraqkmeaigtlaggiahdfnnilgaiigyaeitlhglydspwrpkleriiriserakdlvqqiltfs rhsdhehkpvqpallikeslkllrsslpatieirqdiaatkstimadptrihqimmnlctnaahamret ggvlevslknrdigaaeivpdfqlepgsyvvltirdtgqgippdiqnrifepffttkspgegtglglsv vygivkkyngmvtvdsvprkgatfqvflprvddnltfiqeeeeilpcgsehilfvddetalvemgqetl rtlgyrvtgicnslealetfrrtpslfdliitdmtmpqmtgtvlsrhllqirgdipiilctgysefite keakelgirefimkplfmkelatvirrvldsvpav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.23814
    Matthews' coefficent 2.16 Rfactor 0.22102
    Waters 28 Solvent Content 43.06

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gt7
    1. Purification, crystallization and preliminary X-ray crystallographic analysis of the receiver and stalk domains (PA3346RS) of the response regulator PA3346 from
    PH Wu, JJ Hsu, TW Chiang, YC Hsieh - Section F: Structural , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch