.
The Open Protein Structure Annotation Network
PDB Keyword
.

3guy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a short-chain dehydrogenase/reductase from Vibrio parahaemolyticus. To be Published
    Site NYSGXRC
    PDB Id 3guy Target Id NYSGXRC-11154n
    Molecular Characteristics
    Source Vibrio parahaemolyticus
    Alias Ids TPS27086,3.40.50.720, NP_799018.1 Molecular Weight 23801.83 Da.
    Residues 221 Isoelectric Point 5.14
    Sequence mivitgassglgaelaklydaegkatyltgrsesklstvtnclsnnvgyracdlashqeveqlfeqlds ipstvvhsagsgyfgplekqdpdqiqtliennlssainvlrelvkrykdqpvnvvmimstaaqqpkaqe stycavkwavkgliesvrlelkgkpmkiiavypggmatefwetsgksldtssfmsaedaalmilgalan igngyvsditvnrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.249
    Matthews' coefficent 2.09 Rfactor 0.200
    Waters 586 Solvent Content 41.04

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch