The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Glycerate dehydrogenase related protein from Thermoplasma acidophilum. To be Published
    Site NYSGXRC
    PDB Id 3gvx Target Id NYSGXRC-11143j
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS27070,, NP_394317.1 Molecular Weight 33863.99 Da.
    Residues 303 Isoelectric Point 6.46
    Sequence mdvyvnfpadghvreiaktvldgfdlhwypdyydaeaqvikdryvlgkrtkmiqaisagvdhidvngip envvlcsnagaysisvaehafalllahaknilennelmkagifrqspttllygkalgilgyggigrrva hlakafgmrviaytrssvdqnvdvisespadlfrqsdfvliaipltdktrgmvnsrllanarknltivn varadvvskpdmigflkersdvwylsdvwwnepeitetnlrnailsphvaggmsgeimdiaiqlafenv rnffeghprnvvrkeeyrvrserflgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.261
    Matthews' coefficent 3.03 Rfactor 0.240
    Waters 203 Solvent Content 59.41

    Ligand Information
    Metals K (POTASSIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch