.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gy1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF putative mandelate racemase/muconate lactonizing protein from Clostridium beijerinckii NCIMB 8052. To be Published
    Site NYSGXRC
    PDB Id 3gy1 Target Id NYSGXRC-9459d
    Molecular Characteristics
    Source Clostridium beijerinckii
    Alias Ids TPS27030,82746826, PF01188 Molecular Weight 45228.07 Da.
    Residues 399 Isoelectric Point 5.57
    Sequence veptiitdvlcyitkpdrhnlvvvkvetnkgiyglgcatfqqrpkavslvvseylkpiligrdannied lwqmmmvnsywrngpilnnaisgvdmalwdikgklanmplyqlfggksrdaiaaythavadnledlyte ideirkkgyqhircqlgfyggnssefhttdnptqgsyfdqdeymrttvsmfsslrekygykfhilhdvh erlfpnqavqfakdvekykpyfiedilppdqnewlgqirsqtstplatgelfnnpmewkslianrqvdf irchvsqiggitpalklgslcaafgvriawhtpsditpigvavnihlninlhnaaiqenieindntrcv fsgipeakngffypiespgigvdideneiikypveyrphewtqsripdgtivtp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.212
    Matthews' coefficent 2.36 Rfactor 0.179
    Waters 405 Solvent Content 47.83

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3gy1
    1. Type III secretion chaperones: a molecular toolkit for all occasions
    MS Francis - of molecular chaperones: roles, structures and , 2010 - umu.diva-portal.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch