.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h0u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative enoyl-CoA hydratase from Streptomyces avermitilis. To be Published
    Site NYSGXRC
    PDB Id 3h0u Target Id NYSGXRC-11252c
    Molecular Characteristics
    Source Streptomyces avermitilis
    Alias Ids TPS27168,3.90.226.10, PF00378, NP_821810.1 Molecular Weight 30190.76 Da.
    Residues 285 Isoelectric Point 5.51
    Sequence mtggpkmtasyetikarldgtvlsatfnappmnligpevvrdlvalleelahptaprvvifdsadadff fphvdmtkvpeytaeaakaggpgdaslgmlfrklsqlpavtiaklrgrargagsefllacdmrfasren ailgqpevgigappgagaiqhltrllgrgraleavltssdfdadlaerygwvnravpdaeldefvagia armsgfprdaliaaksainaislpapaevradaalfqqlvrgekvqqrtaelfkqgfqtrgateldlgd alghlkavd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.50 Rfree 0.176
    Matthews' coefficent 2.66 Rfactor 0.159
    Waters 890 Solvent Content 53.79

    Ligand Information
    Ligands DMS (DIMETHYL) x 7
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch