The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative aminotransferase from Silicibacter pomeroyi. TO BE PUBLISHED
    Site NYSGXRC
    PDB Id 3h14 Target Id NYSGXRC-11247n
    Molecular Characteristics
    Source Silicibacter pomeroyi
    Alias Ids TPS27164,YP_167802.1, 3.40.640.10, PF00155 Molecular Weight 41756.11 Da.
    Residues 389 Isoelectric Point 4.77
    Sequence maahweiavknssrsavdpfivmdvmeaarraeeagrriihmevgqpgtgaprgavealaksletdalg ytvalglpalrqriarlygewygvdldpgrvvitpgssggfllaftalfdsgdrvgigapgypsyrqil ralglvpvdlptapenrlqpvpadfagldlaglmvaspanptgtmldhaamgalieaaqaqgasfisde iyhgieyeakavtaleltdecyvinsfskyfsmtgwrvgwmvvpedqvrvveriaqnmficaphasqva alaaldcdaelqanldvykanrklmlerlpkagftriappdgafyvyadvsdltddsrafaaeilekag vavtpgldfdpergagtlrfsyaratadieegldrleafmqarg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.238
    Matthews' coefficent 2.17 Rfactor 0.189
    Waters 231 Solvent Content 43.27

    Ligand Information
    Ligands GOL (GLYCEROL) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch