.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h4u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an amidohydrolase GI:44264246 from an evironmental sample of Sargasso Sea. To be Published
    Site NYSGXRC
    PDB Id 3h4u Target Id NYSGXRC-9236e
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS26996,PF01979 Molecular Weight 51768.05 Da.
    Residues 479 Isoelectric Point 5.87
    Sequence mgadrrgermnleqhagarapntsssrpktllvkhadvlvtmddtrrelrdaglyiednrivavgpsae lpetadevldlrghlvipglvnthhhmyqsltravpaaqnaelfgwltnlykiwahltpemievstlta maellqsgcttssdhlyiypngsrlddsigaaqrigmrfhasrgamsvgqrdgglppdsvverepdilr dtqrlietyhdegryamlrvvvapcspfsvsrdlmrdaavlareygvslhthlaenvndiaysrekfgm tpaeyaedlgwvghdvwhahcvqlddagiglfartgtgvahcpcsnmrlasgiapvkkmrlagvpvglg vdgsasndgaqmvaevrqalllqrvgfgpdamtarealeiatlggakvlnrddigalkpgmaadfaafd lrqplfagalhdpvaalvfcapsqtaytvvngkvvvregrlatldlppvierhnalahalveaar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.280
    Matthews' coefficent 2.21 Rfactor 0.233
    Waters 128 Solvent Content 44.44

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 3h4u
    1. The hunt for 8-oxoguanine deaminase
    RS Hall, AA Fedorov, R Marti-Arbona - Journal of the , 2010 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch