.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h5i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the N-terminal domain of a response regulator/sensory box/GGDEF 3-domain protein from Carboxydothermus hydrogenoformans. To be Published
    Site NYSGXRC
    PDB Id 3h5i Target Id NYSGXRC-11022t
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS27040,3.40.50.2300, Q3ADQ4_CARHZ, PF00072 Molecular Weight 76718.78 Da.
    Residues 668 Isoelectric Point 5.71
    Sequence lkdkkilivedskfqaktianilnkygytveialtgeaavekvsggwypdlilmdielgegmdgvqtal aiqqiselpvvfltahtepavvekirsvtaygyvmksateqvlitivemalrlyeanvhanmywqiled slneiyifnpetlrfhvvnrgarknlgytleelntmtpldlkpefdlksfrallepllsgkeeqivfyt vhrrkdgslypvevhlqlfdyrgeklclalvidlterkaleeenrrkeeqlrlmlealpnptylinrer qiialnqvakergavvgdycwhsihhlktispverqffentgkplpgtkcyfcradealnrkqkencev nldglfwniwwvpidentylhyvidvtkykkmeeeireqkeflrlildsmpagvmvvdaktfrienvnl eaaamigaspeeiigkscfeifpeskglclitavgqemdwaerilhrmdgsqlpvlkivkrlrtksgek lietfidlterkkleeqlyrlsitdyltqaynrryftemlereierakrtkmpfalimldidhfknvnd rfghaagdlvlktlanliknrirqtdclarwggeefvillpntpvekaaglaeelreqlsmleipgvgr vtasfgvtgycpgdtldtllmradqmlytakasgrncvrfsekcpek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.238
    Matthews' coefficent 3.05 Rfactor 0.212
    Waters 22 Solvent Content 59.74

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1;NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 3h5i
    1. Receiver domain structure and function in response regulator proteins
    RB Bourret - Current opinion in microbiology, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch