.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h5l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative branched-chain amino acid ABC transporter from Silicibacter pomeroyi. To be Published
    Site NYSGXRC
    PDB Id 3h5l Target Id NYSGXRC-11233c
    Molecular Characteristics
    Source Silicibacter pomeroyi
    Alias Ids TPS27156,3.40.50.2300, PF01094, YP_167749.1 Molecular Weight 46848.16 Da.
    Residues 439 Isoelectric Point 4.81
    Sequence mtkelqhtqtrrgflksagmatgsaamlaglnsaaqaqssdpvvigcpapltgivaadgiefqrgiqma adeinavggilgrpielvfadtqskgvdvviqsaqrlidrdnasaliagynlengtalhdvaadagvia mhantvavhdemvksdpdrywgtfqydppetlygggflkflkdiedngefsrpnnkiaiitgpgiysvn ianairdgageygydvslfetvaipvsdwgptlaklradppavivvthfypqdqalfmnqfmtdptnsl vylqygaslaafrdiagdnsvgvtyatvlgtlqdemgdafakaykerygdlsstasgcqtysalyaysi aaalaggpgapyddvqnkavadrlrslifrgpvgtmrfhadtqsawsyptetndpslgmphifsqifdk aedgvliapapykkagfkmppwmkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.185
    Matthews' coefficent 2.61 Rfactor 0.159
    Waters 793 Solvent Content 52.90

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch