.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h5o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of transcription regulator GntR from Chromobacterium violaceum. To be Published
    Site NYSGXRC
    PDB Id 3h5o Target Id NYSGXRC-11234b
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS27160,3.40.50.2300, NP_902626.1, PF00532 Molecular Weight 36724.98 Da.
    Residues 339 Isoelectric Point 6.39
    Sequence msrkprvrsgsgvtmhdvakaagvsaitvsrvlnqpqqvseqlrekvmqavdalayvpsrsastlasak srtvlvlipslantvfletltgietvldaagyqmlignshydagqelqllraylqhrpdgvlitglsha epferilsqhalpvvymmdladdgrccvgfsqedagaaitrhllsrgkrrigflgaqldervmkrldgy raaldaadcrdaglewldpqpssmqmgadmldralaerpdcdalfccnddlaigalarsqqlgiavper laiagfndlqpaawctpplttvatprrdigvhaakallqlidgeepasrradlgfrlmlrrss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.2307
    Matthews' coefficent 2.27 Rfactor 0.1892
    Waters 198 Solvent Content 45.79

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch