.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h5t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a transcriptional regulator, Lacl family protein from Corynebacterium glutamicum. To be Published
    Site NYSGXRC
    PDB Id 3h5t Target Id NYSGXRC-11232d
    Molecular Characteristics
    Source Corynebacterium glutamicum
    Alias Ids TPS27154,3.40.50.2300, PF00532, NP_601828.1 Molecular Weight 38859.07 Da.
    Residues 360 Isoelectric Point 5.29
    Sequence mimgrkqqygtlasiaaklgisrttvsnaynrpeqlsaelrqrildtaedmgylgpdpvarslrtrrag aigvlltedltyafedmasvdflagvaqaagdtqltlipaspassvdhvsaqqlvnnaavdgvviysva kgdphidairarglpaviadqpareegmpfiapnnrkaiapaaqalidaghrkigilsirldranndge vtrerlenaqyqvqrdrvrgamevfieagidpgtvpimecwinnrqhnfevakellethpdltavlctv dalafgvleylksvgksapadlsltgfdgthmalardlttviqpnklkgfkagetllkmidkeyvepev eletsfhpgstvapi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.53 Rfree 0.306
    Matthews' coefficent Rfactor 0.288
    Waters 109 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch