.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h6e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of carbohydrate kinase from Novosphingobium aromaticivorans. To be Published
    Site NYSGXRC
    PDB Id 3h6e Target Id NYSGXRC-11200i
    Molecular Characteristics
    Source Novosphingobium aromaticivorans
    Alias Ids TPS27126,PF00370, 3.30.420.40, YP_496330.1 Molecular Weight 51912.15 Da.
    Residues 475 Isoelectric Point 5.05
    Sequence lstgatividlgktlskvslwdldgrmldrqvrpsipleidgirrldapdtgrwlldvlsryadhpvtt ivpvghgagiaaltdgrlafppldyeqsipeavmadyrsqrdpfartgspalpdglnigsqlwwldqlh pdvmanatllpwaqywawfltgravsevtslgchsdlwdpqdgdfspmakrlgwaarfapivragdtvg allpaiaertglspdvqvlaglhdsnaallaargfaeiadneatvlstgtwfiamrlpatpvdtatlpe ardclvnvdvhgrpvpsarfmggreietlieidtrrvdikpdqpallaavpevlrhgrmilptlmrgfg pyphgrfawinrpedwferraaaclyaalvadtaldligstgrilvegrfaeadvfvralaslrpdcav ytanahndvsfgalrlidpglrpqgelvriepldtgswadldtyrnrwqaeveaakvepit
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.2736
    Matthews' coefficent 2.30 Rfactor 0.2199
    Waters 321 Solvent Content 46.41

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch