.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h7a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF SHORT-CHAIN DEHYDROGENASE FROM Rhodopseudomonas palustris. To be Published
    Site NYSGXRC
    PDB Id 3h7a Target Id NYSGXRC-11138g
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS27067,3.40.50.720, CAE25465.1 Molecular Weight 26620.03 Da.
    Residues 245 Isoelectric Point 7.88
    Sequence mtprnatvavigagdyigaeiakkfaaegftvfagrrngeklaplvaeieaaggrivarsldarnedev taflnaadahaplevtifnvganvnfpilettdrvfrkvwemacwagfvsgresarlmlahgqgkifft gataslrggsgfaafasakfglravaqsmarelmpknihvahliidsgvdtawvrerreqmfgkdalan pdllmppaavagaywqlyqqpksawtfemeirpygekw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.87 Rfree 0.24148
    Matthews' coefficent 2.59 Rfactor 0.20550
    Waters 425 Solvent Content 52.62

    Ligand Information
    Ligands UNL (UNKNOWN) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch