.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h7l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF ENDOGLUCANASE-RELATED PROTEIN FROM Vibrio parahaemolyticus. To be Published
    Site NYSGXRC
    PDB Id 3h7l Target Id NYSGXRC-11262d
    Molecular Characteristics
    Source Vibrio parahaemolyticus
    Alias Ids TPS27174,NP_798863.1, 1.50.10.10, PF00759 Molecular Weight 65746.04 Da.
    Residues 579 Isoelectric Point 5.05
    Sequence mllltnhigyerlgpkkaiiqteqphlssytaqlicatseqtvatfaveeqgkvanwhqgyfylidfss ftdsgdyflqvedsrssyftvgehillnqtlsdvihyfksqrcggvfdqqdrqvpvlnanqtvdvhggw ydasgdvskylshlsyanylnpqqtpmvvwnilkglsllegsediaaftrtrlieealfgadflvrmqn ekgffymtvfdkwskdtaqreicayetqlghkfddyqagfrqgggvaiaalaaasrlgvhgeydqqkyr naaengywhlkehntqylndgeeniideycallasvelfkatketryleesrlwaqrlvarqmsdeqiq hfwsanqdgsrpyfhaaeaglpgialceylaieddsvqtesvkcivnracefeikisnkvtnpfgyprq yvkgvneskrdaffvahnnesgywwqgenarlgslatmaylaqphiasqeiqqqlsvfaqdalnwivgl npydmcmldghgrnnpdylpqygffnakggvcngitggfedeediafnppaqkddmlqnwrwgeqwiph gawyllaimsqaqhisqlatsknikeq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.30 Rfree 0.23164
    Matthews' coefficent 3.43 Rfactor 0.18536
    Waters 910 Solvent Content 64.18

    Ligand Information
    Ligands GOL (GLYCEROL) x 5
    Metals

    Jmol

     
    Google Scholar output for 3h7l
    1. _-Glucosidases
    JR Ketudat Cairns, A Esen - Cellular and molecular life sciences, 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch