The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of thioredoxin protein from Geobacter metallireducens. To be Published
    Site NYSGXRC
    PDB Id 3hdc Target Id NYSGXRC-11211i
    Molecular Characteristics
    Source Geobacter metallireducens
    Alias Ids TPS28250,PF08534,, ABB31617.1 Molecular Weight 18826.95 Da.
    Residues 168 Isoelectric Point 9.69
    Sequence mnqllryicaclftltvlavaapgkaesdaplvrtgalapnfklptlsgenkslaqyrgkivlvnfwas wcpycrdempsmdrlvksfpkgdlvvlavnvekrfpekyrrapvsfnflsdatgqvqqryganrlpdtf ivdrkgiirqrvtggiewdapkvvsylksl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.77 Rfree 0.1966
    Matthews' coefficent 3.08 Rfactor 0.1788
    Waters 168 Solvent Content 60.01

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch