.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hdg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the N-terminal domain of an uncharacterized protein (WS1339) from Wolinella succinogenes. To be Published
    Site NYSGXRC
    PDB Id 3hdg Target Id NYSGXRC-11227f
    Molecular Characteristics
    Source Wolinella succinogenes
    Alias Ids TPS28264,3.40.50.2300, CAE10412.1, PF00072 Molecular Weight 43185.95 Da.
    Residues 377 Isoelectric Point 5.59
    Sequence mkmerevalkiliveddtdarewlstiisnhfpevwsagdgeegerlfglhapdviitdirmpklggle mldrikaggakpyvivisafsemkyfikaielgvhlflpkpiepgrlmetledfrhiklaklkkeeaeq erirsllfeskkelirliahhwrqplnvisitaeniklnldergieghedthhladkivteslrlsrvi srfsdtffakeevgrhfglhtvlkdafeiaeplaqearclleiegndevifglkgmlvqillevfkaim alcdqvnrgellvrvvcesfegevkiwmadvacagrcwsevmfepfaggfeekrrdmelfvaqhllrry fdgmikivdrgeirgleitlsrnpkkfnspla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.27 Rfree 0.270
    Matthews' coefficent 2.15 Rfactor 0.223
    Waters 113 Solvent Content 42.92

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 3hdg
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch