.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hdo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of an Histidinol-phosphate aminotransferase from Geobacter metallireducens. To be Published
    Site NYSGXRC
    PDB Id 3hdo Target Id NYSGXRC-11246f
    Molecular Characteristics
    Source Geobacter metallireducens
    Alias Ids TPS28278,ABB30628.1, 3.40.640.10, PF00155 Molecular Weight 39132.41 Da.
    Residues 350 Isoelectric Point 5.58
    Sequence miplrqniasmkgyipgyqppdiaswiklntnenpyppspevvkaileelgpdgaalriypsassqklr evagelygfdpswiimangsdevlnnlirafaaegeeigyvhpsysyygtlaevqgarvrtfgltgdfr iagfperyegkvfflttpnaplgpsfpleyidelarrcagmlvldetyaefaesnalelvrrhenvvvt rtlsksyslagmriglaiarpeviaaldkirdhynldrlaqaacvaalrdqaylseccrriretrewft telrsigydvipsqgnylfatppdrdgkrvydglyarkvlvrhfsdpllahgmrisigtreemeqtlaa lkeig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.61 Rfree 0.202
    Matthews' coefficent 1.99 Rfactor 0.185
    Waters 521 Solvent Content 38.07

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3hdo
    1. Crystal Structures and Repair Studies Reveal the Identity and the Base_Pairing Properties of the UV_Induced Spore Photoproduct DNA Lesion
    K Heil, AC Kneuttinger, S Schneider - -A European Journal, 2011 - Wiley Online Library
     
    2. Fragment Finder 2.0: a computing server to identify structurally similar fragments
    R Nagarajan, S Siva Balan, R Sabarinathan - Journal of Applied , 2012 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch