.
The Open Protein Structure Annotation Network
PDB Keyword
.

3heb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Response regulator receiver domain from Rhodospirillum rubrum. To be Published
    Site NYSGXRC
    PDB Id 3heb Target Id NYSGXRC-11237b
    Molecular Characteristics
    Source Rhodospirillum rubrum
    Alias Ids TPS28274,3.40.50.2300, YP_425756.1, PF00072 Molecular Weight 16437.84 Da.
    Residues 148 Isoelectric Point 5.33
    Sequence mssaaqsvtivmieddlgharlieknirragvnneiiaftdgtsalnylfgddksgrvsagraqlvlld lnlpdmtgidilklvkenphtrrspvviltttddqreiqrcydlganvyitkpvnyenfanairqlglf fsvmqvpetn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.255
    Matthews' coefficent 2.10 Rfactor 0.203
    Waters 122 Solvent Content 41.45

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch