.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hg9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF putative pilM protein from Pseudomonas aeruginosa 2192. To be Published
    Site NYSGXRC
    PDB Id 3hg9 Target Id NYSGXRC-10170d
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS28292,Q6X3P5, PF07419 Molecular Weight 15107.52 Da.
    Residues 145 Isoelectric Point 9.29
    Sequence mplmwivlvlalitgtwlsvqsnhatssaelaevdtlarslllyrsrlaeyahanpgfsgspadsalgl pawfrkpvrlqgyiaagtsyafiasppaglaaavdtgtesdlvgvrrngqlvtrrlgataialpapipe gavvavk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.267
    Matthews' coefficent 3.14 Rfactor 0.235
    Waters 183 Solvent Content 60.83

    Ligand Information
    Ligands
    Metals NI (NICKEL) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch