.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hh0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal strucure of a transcriptional regulator, MerR family from Bacillus cereus. To be Published
    Site NYSGXRC
    PDB Id 3hh0 Target Id NYSGXRC-11183j
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS28244,PF09278, NP_830739.1, 1.10.1660.10 Molecular Weight 29327.11 Da.
    Residues 245 Isoelectric Point 5.49
    Sequence mawlisefasvgdvtvralryydkinllkpsdytegghrlytkddlyvlqqiqsfkhlgfslgeiqnii lqrdietevflrqmhfqrevllaeqeriakvlshmdemtkkfqkeervnvalfssflqtfiwekenkew leehfstesiqafynnkelkekfdrrfmdvigklkkykeeekdpshhdvqvtlkeffhliekitdyldi sqsevvsvikqskismaefptlftneeeqyikeamnkm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.67 Rfree 0.269
    Matthews' coefficent 2.42 Rfactor 0.217
    Waters 126 Solvent Content 49.08

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch