.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hin

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF putative enoyl-CoA hydratase from Rhodopseudomonas palustris CGA009. To be Published
    Site NYSGXRC
    PDB Id 3hin Target Id NYSGXRC-11251g
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS28284,3.90.226.10, PF00378, CAE27227.1 Molecular Weight 28461.15 Da.
    Residues 268 Isoelectric Point 7.20
    Sequence vltgnaqaatiadpstlvvdtvgpvltiglnrpkkrnalndglmaalkdcltdipdqiravvihgigdh fsagldlselrerdateglvhsqtwhrvfdkiqycrvpviaalkgaviggglelacaahirvaeasayy alpegsrgifvggggsvrlprligvarmadmmltgrvysaaegvvhgfsqyliengsaydkalelgnrv aqnapltnfavlqalpmiaeanpqtgllmeslmatvaqsdqeaktrirafldhktakvrps
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.274
    Matthews' coefficent 2.71 Rfactor 0.225
    Waters 242 Solvent Content 54.53

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch