.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hm7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Allantoinase from Bacillus Halodurans. To be Published
    Site NYSGXRC
    PDB Id 3hm7 Target Id NYSGXRC-9585a
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS28202,15614872, PF01979 Molecular Weight 48539.76 Da.
    Residues 438 Isoelectric Point 5.90
    Sequence mkrfdliirsstvvtetttyradvairngivsaitepgsissddgpaidgtglhlfpgmvdvhvhfnep grtewegfasgskslaaggvttyfdmplnsnpptitreeldkkrqlanekslvdyrfwgglvpgnidhl qdlhdggvigfkafmsecgtddfqfshdetllkgmkkiaalgsilavhaesnemvnalttiaieeqrlt vkdysearpivseleaverilrfaqltccpihichvssrkvlkrikqakgegvnvsvetcphyllfsld efaeigylakcapplrerqevedlwdglmageidlissdhspslpqmktgktifevwggiagcqntlav mltegyhkrkmpltqivqllstepakrfglypqkgtiqvgaeasftlidlnesytlnasdlyyrhpisp yvgqrfrgkvkhticqgkhvyqdh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.60 Rfree 0.26730
    Matthews' coefficent 2.52 Rfactor 0.23969
    Waters 371 Solvent Content 51.22

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 6

    Jmol

     
    Google Scholar output for 3hm7
    1. Identification of two-histidines one-carboxylate binding motifs in proteins amenable to facial coordination to metals
    B Amrein, M Schmid, G Collet, P Cuniasse, F Gilardoni - Metallomics, 2012 - xlink.rsc.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch