.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hmu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a class III aminotransferase from Silicibacter pomeroyi. To be Published
    Site NYSGXRC
    PDB Id 3hmu Target Id NYSGXRC-11247m
    Molecular Characteristics
    Source Silicibacter pomeroyi
    Alias Ids TPS28280,YP_168667.1, 3.40.640.10, PF00202 Molecular Weight 50682.94 Da.
    Residues 464 Isoelectric Point 5.36
    Sequence matitnhmptaelqaldaahhlhpfsannalgeegtrvitrargvwlndsegeeildamaglwcvnigy grdelaevaarqmrelpyyntffktthvpaialaqklaelapgdlnhvffagggseandtnirmvrtyw qnkgqpektviisrknayhgstvassalggmagmhaqsglipdvhhinqpnwwaeggdmdpeefglara releeailelgenrvaafiaepvqgaggvivapdsywpeiqricdkydilliadevicgfgrtgnwfgt qtmgirphimtiakglssgyapiggsivcdevahvigkdefnhgytysghpvaaavalenlrileeeni ldhvrnvaapylkekwealtdhplvgeakivgmmasialtpnkasrakfasepgtigyicrercfannl imrhvgdrmiispplvitpaeidemfvrirksldeaqaeiekqglmksaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.193
    Matthews' coefficent 2.31 Rfactor 0.150
    Waters 666 Solvent Content 46.67

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 3hmu
    1. Reversed Enantiopreference of an __Transaminase by a Single_Point Mutation
    M Svedendahl, C Branneby, L Lindberg - , 2010 - Wiley Online Library
     
    2. Discovery and Protein Engineering of Biocatalysts for Organic Synthesis
    GA Behrens, A Hummel, SK Padhi - Advanced Synthesis , 2011 - Wiley Online Library
     
    3. Crystallization and preliminary X-ray crystallographic studies of omega-transaminase from Vibrio fluvialis JS17
    T Jang, B Kim, OK Park, JY Bae, BG Kim - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Crystal structures of the Chromobacterium violaceum__transaminase reveal major structural rearrangements upon binding of coenzyme PLP
    MS Humble, KE Cassimjee, M Hkansson - FEBS , 2012 - Wiley Online Library
     
    5. Key Amino Acid Residues for Reversed or Improved Enantiospecificity of an __Transaminase
    MS Humble, KE Cassimjee, V Abedi - , 2012 - Wiley Online Library
     
    6. Biocatalysis using S9 _-transaminase expressed in Escherichia coli
    MN Muraleedharan - 2011 - kth.diva-portal.org
     
    7. Identification, characterization and application of novel (R)-selective amine transaminases
    S Schtzle - 2012 - ub-ed.ub.uni-greifswald.de
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch