.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hp0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Putative polyketide biosynthesis enoyl-CoA hydratase (pksH) from Bacillus subtilis. To be Published
    Site NYSGXRC
    PDB Id 3hp0 Target Id NYSGXRC-11251f
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS28282,3.90.226.10, PF00378, CAB13587.1 Molecular Weight 29377.19 Da.
    Residues 259 Isoelectric Point 6.34
    Sequence vdlvtyqtikvrfqasvcyitfhrpeanntindtlieeclqvlnqcetstvtvvvleglpevfcfgadf qeiyqemkrgrkqassqeplydlwmklqtgpyvtishvrgkvnagglgfvsatdiaiadqtasfslsel lfglypacvlpflirrigrqkahymtlmtkpisvqeasewglidafdaesdvllrkhllrlrrlnkkgi ahykqfmssldhqvsrakataltanqdmfsdpqnqmgiiryvetgqfpwedq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.32 Rfree 0.270
    Matthews' coefficent 2.23 Rfactor 0.232
    Waters 209 Solvent Content 44.96

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch