.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hqc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Phosphotyrosine-binding domain from the Human Tensin-like C1 domain-containing phosphatase (TENC1). To be Published
    Site NYSGXRC
    PDB Id 3hqc Target Id NYSGXRC-13157b
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS28228,NP_736610 Molecular Weight 152571.94 Da.
    Residues 1409 Isoelectric Point 8.67
    Sequence mkssgpverllralgrrdssraasrprkaephsfrekvfrkkppvcavckvtidgtgvscrvckvathr kceakvtsacqalppvelrrntapvrriehlgstkslnhskqrstlprsfsldplmerrwdldltyvte rilaaafparpdeqrhrghlrelahvlqskhrdkyllfnlsekrhdltrlnpkvqdfgwpelhappldk lcsickametwlsadpqhvvvlyckgnkgklgvivsaymhyskisagadqalatltmrkfcedkvatel qpsqrryisyfsgllsgsirmnssplflhyvlipmlpafepgtgfqpflkiyqsmqlvytsgvyhiagp gpqqlcislepalllkgdvmvtcyhkggrgtdrtlvfrvqfhtctihgpqltfpkdqldeawtderfpf qasvefvfssspekikgstprndpsvsvdynttepavrwdsyenfnqhhedsvdgslthtrgpldgspy aqvqrpprqtppapspepppppmlsvssdsghsstlttepaaespgrppptaaerqeldrllggcgvas ggrgagretailddeeqptvgggphlgvypghrpglsrhcscrqgyrepcgvpnggyyrpegtlerrrl ayggyegspqgyaeasmekrrlcrslseglypyppemgkpatgdfgyrapgyrevviledpglpalypc paceeklalptaalyglrlereagegwaseagkpllhpvrpghplplllpacghhhapmpdysclkppk ageeghegcsytmcpegryghpgypalvtysyggavpsycpaygrvphscgspgegrgypspgahspra gsispgsppypqsrklsyeipteeggdryplpghlasagplasaeslepvswregpsghstlprsprda pcsasselsgpstplhtsspvqgkestrrqdtrsptsaptqrlspgealppvsqagtgkapelpsgsgp eplapspvsptfppsspsdwpqerspgghsdgasprspvpttlpglrhapwqgprgppdspdgspltpv psqmpwlvaspeppqssptpafplaasydtnglsqpplpekrhlpgpgqqpgpwgpeqasspargishh vtfapllsdnvpqtpepptqesqsnvkfvqdtskfwykphlsrdqaiallkdkdpgaflirdshsfqga yglalkvatpppsaqpwkgdpveqlvrhflietgpkgvkikgcpsepyfgslsalvsqhsispislpcc lripskdpleetpeapvptnmstaadllrqgaacsvlyltsvetesltgpqavarassaalscsprptp avvhfkvsaqgitltdnqrklffrrhypvnsitfsstdpqdrrwtnpdgttskifgfvakkpgspwenv chlfaeldpdqpagaivtfitkvllgqrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.242
    Matthews' coefficent 3.58 Rfactor 0.212
    Waters 85 Solvent Content 65.64

    Ligand Information
    Ligands SO4 (SULFATE) x 3;ACT (ACETATE) x 2;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3hqc
    1. Solution structure of the PTB domain of human Tensin2 in complex with deleted in liver cancer 1 (DLC1) peptide reveals a novel peptide binding mode
    L Chen, C Liu, FCF Ko, N Xu, IO Ng, JWP Yam - Journal of Biological , 2012 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch