The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of periplasmic binding ribose operon repressor protein from Lactobacillus acidophilus. To be Published
    Site NYSGXRC
    PDB Id 3hs3 Target Id NYSGXRC-11235h
    Molecular Characteristics
    Source Lactobacillus acidophilus
    Alias Ids TPS28268,, PF00532, YP_194323.1 Molecular Weight 35730.93 Da.
    Residues 319 Isoelectric Point 8.89
    Sequence mttirdiaklsgvsvatvsriinhsgkvsettkqkvekiisqthyqpnqvartlyqkkskmigiiipdl nnrfyaqiidgiqeviqkegytalisfstnsdvkkyqnaiinfennnvdgiitsaftippnfhlntplv mydsaninddivrivsnntkggkesikllskkiekvliqhwplslptirerieamtaeasklkidylle etpennpyisaqsalnksnqfdaiitvndlyaaeiikeakrrnlkipddfqlvgydnnilcgytsptis tidqnpkligqtaahrlldlmsgnnstrnsiidvlpikrdstl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.234
    Matthews' coefficent 2.33 Rfactor 0.212
    Waters 377 Solvent Content 47.28

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch