.
The Open Protein Structure Annotation Network
PDB Keyword
.

3huh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium. To be Published
    Site NYSGXRC
    PDB Id 3huh Target Id NYSGXRC-13955a
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS28196,PF00903, AAL21991.1 Molecular Weight 16145.65 Da.
    Residues 144 Isoelectric Point 5.12
    Sequence mlffnvaslkykhhesiqmiidridhlvltvsdisttirfyeevlgfsavtfkqnrkalifgaqkinlh qqemefepkasrptpgsadlcfitstpindvvseilqagisivegpvertgatgeimsiyirdpdgnli eisqyv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.50 Rfree 0.256
    Matthews' coefficent 1.91 Rfactor 0.236
    Waters 311 Solvent Content 35.52

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3huh
    1. Progress in super long loop prediction
    S Zhao, K Zhu, J Li, RA Friesner - Proteins: Structure, Function, , 2011 - Wiley Online Library
     
    2. Cruzain
    M Sajid, SA Robertson, LS Brinen - Cysteine Proteases of , 2011 - Springer
     
    3. Towards High-resolution Computational Approaches for Structure-based Drug Discovery
    J Li - 2011 - academiccommons.columbia.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch