.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hul

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative homoserine kinase thrB from Listeria monocytogenes. To be published
    Site NYSGXRC
    PDB Id 3hul Target Id NYSGXRC-13788a
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS28194,CAD00623.1, PF00288 Molecular Weight 30830.51 Da.
    Residues 288 Isoelectric Point 4.81
    Sequence mrirvpattanlgpgfdscglaltlyltldigaeadswyiehnigggiphdetnviietalnlapnltp hhlvmtcdipparglgsssaavvagielantlaelnlskeekvriaaeieghpdnvapavlgnwvvgak ldgedfyvrhlfpdcaliafipkaelltsesrgvlpdtlpfkeavqassianvmiaailrndmtlagem merdlwhekyrsqlvphlaqirdvaknqgayaaclsgagptvlvfaprnlanklqtslqtleidadvll ldvegsgaevfr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.19 Rfree 0.270
    Matthews' coefficent 2.34 Rfactor 0.226
    Waters 56 Solvent Content 47.35

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch