.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hur

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of alanine racemase from Oenococcus oeni. To be Published
    Site NYSGXRC
    PDB Id 3hur Target Id NYSGXRC-11082j
    Molecular Characteristics
    Source Oenococcus oeni
    Alias Ids TPS28230,3.20.20.10, ABJ57491.1 Molecular Weight 43058.84 Da.
    Residues 386 Isoelectric Point 5.38
    Sequence mvtaihrptwvsvdldaaahnlqeirewtkakkvyavlkadgyglgaiplakafqetasadalivsnld ealelrqadltlpiwvlgawdysdlklfidhdivitipslawlqnlpdfegtlkvslaidtgmtrigfd kadeisaakkiidknpqldlfsvythfatadeagekskayfeeqlrrwqeltinqgfdpslfsmansat ciwhhddprisfaairpgqlisgvnvsngelkmppnlhlerifsvcseiadvrfvkkdqslsygaserm pedgyvatlpfgyndgwlrrmqkssviingkrmpiigritmdqtmvkldrkypigtrvtligkdggeqi tveevanyshtivdeiqttlaprikriytgdlaeviganyg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.252
    Matthews' coefficent 4.14 Rfactor 0.219
    Waters 32 Solvent Content 70.30

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 3hur
    1. The crystal structure of alanine racemase from Streptococcus pneumoniae, a target for structure-based drug design
    H Im, ML Sharpe, U Strych, M Davlieva - BMC , 2011 - ncbi.nlm.nih.gov
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch