.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hut

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative branched-chain amino acid ABC transporter from Rhodospirillum rubrum. To be Published
    Site NYSGXRC
    PDB Id 3hut Target Id NYSGXRC-11236m
    Molecular Characteristics
    Source Rhodospirillum rubrum
    Alias Ids TPS28272,3.40.50.2300, YP_427957.1, PF01094 Molecular Weight 41860.97 Da.
    Residues 394 Isoelectric Point 4.74
    Sequence mkvfgrigpfcallamlglglvspsaaredtgegvsqepalllgyelpltganaaygrvfqeaarlqld rfnaaggvggrpvdilyadsrddadqartiarafvddprvvgvlgdfsstvsmaagsiygkegmpqlsp taahpdyikispwqfraittpafegpnnaawmigdgftsvavigvttdwglssaqafrkafelrggavv vneevppgnrrfddvideiedeapqaiylamayedaapflralrargsalpvygssalyspkfidlggp avegvrlatafvlgasdpvvvefvsayetlygaiptlfaahgydavgimlaavgragpevtreslrdal aatdryagvtgitrfdpetrettkiltrlvvregdfrvidrsdfspvlp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.93 Rfree 0.228
    Matthews' coefficent 2.09 Rfactor 0.183
    Waters 338 Solvent Content 41.12

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch