.
The Open Protein Structure Annotation Network
PDB Keyword
.

3huu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of transcription regulator like protein from Staphylococcus haemolyticus. To be Published
    Site NYSGXRC
    PDB Id 3huu Target Id NYSGXRC-11235m
    Molecular Characteristics
    Source Staphylococcus haemolyticus
    Alias Ids TPS28270,3.40.50.2300, PF00532, YP_253322.1 Molecular Weight 33454.28 Da.
    Residues 295 Isoelectric Point 5.47
    Sequence msklgyipnqaartlitnktltigliqkssapeirqnpfnsdvlnginqacnvrgystrmtvsensgdl yhevktmiqsksvdgfillyslkddpiehllnefkvpylivgkslnyeniihidndnidaayqltqyly hlghrhilflqesghyavtedrsvgfkqycddvkisndcvviksmndlrdfikqycidashmpsviits dvmlnmqllnvlyeyqlripediqtatfntsfltenatpsqtsvninpdvlgftagntiidvlrnetis freklistqivervsttki
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.274
    Matthews' coefficent 2.36 Rfactor 0.237
    Waters 128 Solvent Content 47.95

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch