.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hv1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a polar amino acid ABC uptake transporter substrate binding protein from Streptococcus thermophilus. To be Published
    Site NYSGXRC
    PDB Id 3hv1 Target Id NYSGXRC-11316l
    Molecular Characteristics
    Source Streptococcus thermophilus
    Alias Ids TPS28290,3.40.190.10, PF00497, AAV60546.1 Molecular Weight 31617.40 Da.
    Residues 283 Isoelectric Point 6.02
    Sequence mkkivktvllaclvilplftlsacssrshfatqkdqwqtytkekkikigfdatfvpmgyeekdgsyigf didlanavfklygidvewqaidwdmketelkngtidliwngysvtderkqsadftepymvneqvlvtkk ssgidsvagmagktlgaqagssgydafnaspkilkdvvanqkvvqystftqalidlnsgridgllidrv yanyyleksgvldqynvmpagyegesfavgarkvdktlikkinqgfetlykngefqkisnkwfgedvat dqvkgkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.254
    Matthews' coefficent 2.36 Rfactor 0.222
    Waters 281 Solvent Content 47.94

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch