.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hv2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of signal receiver domain oF HD domain-containing protein 3 FROM Pseudomonas fluorescens. To be Published
    Site NYSGXRC
    PDB Id 3hv2 Target Id NYSGXRC-11233j
    Molecular Characteristics
    Source Pseudomonas fluorescens
    Alias Ids TPS28266,3.40.50.2300, YP_261976.1, PF00072 Molecular Weight 50406.19 Da.
    Residues 448 Isoelectric Point 5.90
    Sequence mgelnvatvtrrpeillvdsqevilqrlqqllsplpytlhfardatqalqllasrevdlvisaahlpqm dgptllarihqqypsttrilltgdpdlkliakainegeiyrylskpwddqelllalrqalehqhserer lrlqdlaqqqnaelkalntllekrvaartselqqtadmldlayeelkpsyatgaelfsllvnqrlpadk qtnrriielvrayckvqgidpgaqrdlamaaalhnigklswsdsmmtspadllhhhqreryraypaqse sllmtlepvqdaarlirhhqehwdgsgfpdhlkgdaiplgsrllklavdfielqcglilerhmnsdeal vfirkyagrlydpdlvegfiqvcavylsdvtlgdpsvkvlstrelaagmilarnlnadngmlllnagkv lnlplvdkliafetmegarysvfvklpqeqqara
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.19325
    Matthews' coefficent 2.00 Rfactor 0.16331
    Waters 394 Solvent Content 38.59

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch