.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i3v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of probable secreted solute-binding lipoprotein from Streptomyces coelicolor. To be Published
    Site NYSGXRC
    PDB Id 3i3v Target Id NYSGXRC-11318g
    Molecular Characteristics
    Source Streptomyces coelicolor
    Alias Ids TPS31707,3.40.190.10, PF01547, NP_624773.1 Molecular Weight 45836.17 Da.
    Residues 429 Isoelectric Point 6.04
    Sequence vrssltrrellaagsglaaaaalpalsgcsslasadsdpdtlvvhtqlgttapgsptylaavdrfreen pgvkiknlvngddlaqvyetsrlarkeadvvmvnlydktlawtdvgatvdvkpylddwglrgrvlpaal adwtddegrvrafpyfatnwpvaynralldragvdaipttgdqliaaarklrakgiapvtvggndwtgq kllaqiiqtflsqdearhvystgdfgvrgarlgieyfahlrdagvfadkaqgltsdsmttqfnteeaav qsamssalakvpekvaghtevggwpladgaahdgptviraytligfwispngvrkieqvekflrfmyrp dvvarfvtesgrdmalrtdavstgfplvgaaqrlgsevsqvllpdvyvppaaaqplitatstsftrgts parvraalesayrsv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.259
    Matthews' coefficent 2.52 Rfactor 0.220
    Waters 329 Solvent Content 51.13

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch