.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i3y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Ribokinase in Complex with D-Ribose from Klebsiella pneumoniae. To be Published
    Site NYSGXRC
    PDB Id 3i3y Target Id NYSGXRC-11206l
    Related PDB Ids 3ikh 
    Molecular Characteristics
    Source Klebsiella pneumoniae
    Alias Ids TPS31663,ABR77160.1, PF00294, 3.40.1190.20 Molecular Weight 30685.05 Da.
    Residues 290 Isoelectric Point 5.19
    Sequence mrvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrliaatgndsngawi rqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfsldemiphmadavagdillqqgn fsldktralfqyarsrgmttvfnpspvnpdfchlwplidiavvneseaellqpygvktlvitqgaagaw lvqegqrqfcpavpaealdttgagdtflavmlasallrgvapdalalahasraaaitvsrrgtlsafpg srelaallttdgar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.15 Rfree 0.276
    Matthews' coefficent 2.69 Rfactor 0.244
    Waters 199 Solvent Content 54.26

    Ligand Information
    Ligands SO4 (SULFATE) x 6;GOL (GLYCEROL) x 1;RIB (RIBOSE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch