.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i42

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of response regulator receiver domain (CheY-like) from Methylobacillus flagellatus. To be published
    Site NYSGXRC
    PDB Id 3i42 Target Id NYSGXRC-11237j
    Molecular Characteristics
    Source Methylobacillus flagellatus
    Alias Ids TPS31682,3.40.50.2300, YP_545845.1, PF00072 Molecular Weight 14782.14 Da.
    Residues 134 Isoelectric Point 4.44
    Sequence mqimtlknnnggdlekqaqqalivedyqaaaetfkellemlgfqadyvmsgtdalhamstrgydavfid lnlpdtsglalvkqlralpmektskfvavsgfakndlgkeacelfdfylekpidiaslepilqsi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.240
    Matthews' coefficent 2.28 Rfactor 0.205
    Waters 9 Solvent Content 46.12

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch