.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i45

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF putative twin-arginine translocation pathway signal protein from Rhodospirillum rubrum Atcc 11170. To be Published
    Site NYSGXRC
    PDB Id 3i45 Target Id NYSGXRC-11237a
    Molecular Characteristics
    Source Rhodospirillum rubrum
    Alias Ids TPS31681,3.40.50.2300, YP_425654.1, PF01094 Molecular Weight 45617.61 Da.
    Residues 421 Isoelectric Point 8.87
    Sequence mnkqpaartalkkpasgvgrraflagsaagilglaapairraqaaeairigeinsysqipaftlpyrng wqlaveqinaaggllggrplevisrddggdpgkavtaaqelltrhgvhalagtflshvglavsdfarqr kvlfmasepltdaltwekgnrytyrlrpstymqaamlaaeaaklpitrwatiapnyeygqsavarfkel llaarpevtfvaeqwpalykldagptvqalqqaepeglfnvlfgadlpkfvregrvrglfagrqvvsml tgepeylnplkdeapegwivtgypwydidtaphrafveayrarwkedpfvgslvgyntltamavafeka ggtesetlvetlkdmafstpmgplsfrasdhqstmgawvgrtalrdgkgvmvdwryvdggsvlpppevv sawrpag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.36 Rfree 0.174
    Matthews' coefficent 2.22 Rfactor 0.158
    Waters 436 Solvent Content 44.48

    Ligand Information
    Ligands NIO (NICOTINIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 3i45
    1. Characterization of transport proteins for aromatic compounds derived from lignin: benzoate derivative binding proteins
    K Michalska, C Chang, JC Mack, S Zerbs - Journal of Molecular , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch