.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i47

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF putative enoyl CoA hydratase/isomerase (crotonase) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1. To be Published
    Site NYSGXRC
    PDB Id 3i47 Target Id NYSGXRC-11251c
    Molecular Characteristics
    Source Legionella pneumophila
    Alias Ids TPS31688,3.90.226.10, PF00378, AAU27907.1 Molecular Weight 30910.87 Da.
    Residues 282 Isoelectric Point 7.81
    Sequence lrilvsvyfackrkgtigmsdllyeiqdkvglltmnriskhnafdnqlltemrirldsaindtnvrviv lkangkhfsagadltwmqsmanfteeenledslvlgnlmysisqspkptiamvqgaafgggaglaaacd iaiastsarfcfsevklglipavispyvvraigeraakmlfmsaevfdatrayslnlvqhcvpddtlle ftlkyasqisnnapeavknskqlaqyvankkideelvrytasliahkrvsdegqeglkaflnkeipnwn kgsghv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.58 Rfree 0.179
    Matthews' coefficent 3.80 Rfactor 0.168
    Waters 349 Solvent Content 67.61

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch