.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i4j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Aminotransferase, class III from Deinococcus radiodurans. To be Published
    Site NYSGXRC
    PDB Id 3i4j Target Id NYSGXRC-11246c
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS28276,AAF12235.1, 3.40.640.10, PF00202 Molecular Weight 44898.61 Da.
    Residues 430 Isoelectric Point 5.63
    Sequence msnvfyrsskpypvavrgegvflyddagrryldgssgalvanighgraevgermaaqaarlpfvhgsqf ssdvleeyagrlarfvglptfrfwavsggseatesavklarqyhvergepgrfkvitrvpsyhgaslgs laasgmgarrelytplmrpeawpklpkpdparngaedaeglralleregpetvaafmaepvvgasdaal apapgyyervrdicdeagiifiadevmsgmgrcgsplalsrwsgvtpdiavlgkglaagyaplagllaa pqvyetvmggsgafmhgftyaghpvsvaaglsvldiveredltgaakergaqllaglqalqarfpqmmq vrgtglllgvvlgdlatgqafetpgiasrigaaalkrglitypgsgaepngrgdhlllgpplsitaaev dellallagaledvlg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.239
    Matthews' coefficent 2.17 Rfactor 0.218
    Waters 495 Solvent Content 43.44

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch