.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i4s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF HISTIDINE TRIAD PROTEIN FROM Bradyrhizobium japonicum. To be Published
    Site NYSGXRC
    PDB Id 3i4s Target Id NYSGXRC-9465d
    Molecular Characteristics
    Source Bradyrhizobium japonicum usda 110
    Alias Ids TPS31587,PF01230, 27383233 Molecular Weight 19461.56 Da.
    Residues 172 Isoelectric Point 9.46
    Sequence mqyrrspdpspigigivwsnptspshrairktfmsepawslhsrlkedtidigdlplskvlvikdanyp wlllvprrpdaveiidldevqqaqlmteisrvsralkeitkcdklniaalgnlvpqlhvhiiarrtgda awprpvwgvmqplahdatevqnfisalrrkiwlg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.21821
    Matthews' coefficent 2.16 Rfactor 0.17808
    Waters 259 Solvent Content 43.11

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch