.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i5t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF AMINOTRANSFERASE PRK07036 FROM Rhodobacter sphaeroides. To be Published
    Site NYSGXRC
    PDB Id 3i5t Target Id NYSGXRC-11249h
    Molecular Characteristics
    Source Rhodobacter sphaeroides
    Alias Ids TPS31686,YP_355036.1, 3.40.640.10, PF00202 Molecular Weight 50152.28 Da.
    Residues 467 Isoelectric Point 5.32
    Sequence mtrndatnaagavgaamrdhillpaqemaklgksaqpvlthaegiyvhtedgrrlidgpagmwcaqvgy grreivdamahqamvlpyaspwymatspaarlaekiatltpgdlnriffttggstavdsalrfsefynn vlgrpqkkriivrydgyhgstaltaactgrtgnwpnfdiaqdrisflsspnprhagnrsqeaflddlvq efedrieslgpdtiaaflaepilasggviippagyharfkaicekhdilyisdevvtgfgrcgewfase kvfgvvpdiitfakgvtsgyvplgglaiseavlarisgenakgswftngytysnqpvacaaalanielm eregivdqaremadyfaaalaslrdlpgvaetrsvglvgcvqclldptradgtaedkaftlkidercfe lglivrplgdlcvisppliisraqidemvaimrqaitevsaahgltakepaav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.23440
    Matthews' coefficent 2.12 Rfactor 0.18054
    Waters 593 Solvent Content 42.09

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3i5t
    1. Crystal structures of the Chromobacterium violaceum__transaminase reveal major structural rearrangements upon binding of coenzyme PLP
    MS Humble, KE Cassimjee, M Hkansson - FEBS , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch