.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i6e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of muconate lactonizing enzyme from Ruegeria pomeroyi. To be Published
    Site NYSGXRC
    PDB Id 3i6e Target Id NYSGXRC-9468a
    Molecular Characteristics
    Source Ruegeria pomeroyi dss-3
    Alias Ids TPS31591,56698487, PF01188 Molecular Weight 40822.50 Da.
    Residues 376 Isoelectric Point 5.04
    Sequence mmgdleqkiiamdlwhlalpvvsardhgigrvegsceivvlrlvaeggaegfgeaspwavftgtpeasy aaldrylrplvigrrvgdrvaimdeaaravahcteakaaldsalldlagrisnlpvwallggkcrdtip lscsianpdfdadialmerlradgvgliklktgfrdhafdimrleliardfpefrvrvdynqgleidea vprvldvaqfqpdfieqpvrahhfelmarlrgltdvplladesvygpedmvraahegicdgvsikimks ggltraqtvariaaahglmayggdmfeaglahlagthmiaatpeitlgcefyqasyflnediletpfrv eagqvivpdgpglgaradpeklehyavrrsg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.70 Rfree 0.263
    Matthews' coefficent 2.42 Rfactor 0.235
    Waters 937 Solvent Content 49.21

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 8;MG (MAGNESIUM) x 8

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch