.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i6t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of muconate cycloisomerase from Jannaschia sp. To be Published
    Site NYSGXRC
    PDB Id 3i6t Target Id NYSGXRC-9469a
    Molecular Characteristics
    Source Jannaschia sp. ccs1
    Alias Ids TPS31592,89053899, PF01188 Molecular Weight 40052.57 Da.
    Residues 371 Isoelectric Point 5.27
    Sequence msdqsqiiagftlwhlslpvtarrdhgigsvagavevvvlrlqadsgavgygeaspwvvftgsveatya aldrylrplvlgravgdhaaimedaraavahcteakaaldtalydlrariagvpvwallggrcrdripl scsiadpdfdkdlalmqrlqdddvriiklktgfkdhafdmmrlerlradfpafdirvdynqglhhdval arvrdvatfkptfieqpvkahlrglmarirdavdvplladesifgpedmaehpeiadgvsikimksggl traqtvarmaaarglsayggdmfeaglahlagahmiaatpeitlgcefyqatyflcddilaapfpvadg hvlvpdtpglgvdvdedalarfavar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.205
    Matthews' coefficent 2.44 Rfactor 0.169
    Waters 966 Solvent Content 49.68

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 4;K (POTASSIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch