.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i76

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the orthorhombic form of the putative HAD-hydrolase YfnB from Bacillus subtilis bound to magnesium reveals interdomain movement. To be Published
    Site NYSGXRC
    PDB Id 3i76 Target Id NYSGXRC-9615a
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS31600,PF00702, 2633046 Molecular Weight 27379.70 Da.
    Residues 235 Isoelectric Point 4.83
    Sequence mkryrtllfdvddtildfqaaealalrllfedqnipltndmkaqyktinqglwrafeegkmtrdevvnt rfsallkeygyeadgalleqkyrrfleeghqlidgafdlisnlqqqfdlyivtngvshtqykrlrdsgl fpffkdifvsedtgfqkpmkeyfnyvferipqfsaehtliigdsltadikggqlagldtcwmnpdmkpn vpeiiptyeirkleelyhilnientvsc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.00 Rfree 0.219
    Matthews' coefficent 2.35 Rfactor 0.175
    Waters 405 Solvent Content 47.75

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals CL (CHLORIDE) x 4;MG (MAGNESIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch