.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i8b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of xylulose kinase from Bifidobacterium adolescentis. To be Published
    Site NYSGXRC
    PDB Id 3i8b Target Id NYSGXRC-11200j
    Molecular Characteristics
    Source Bifidobacterium adolescentis
    Alias Ids TPS31653,PF00370, YP_909295.1, 3.30.420.40 Molecular Weight 52666.00 Da.
    Residues 506 Isoelectric Point 4.69
    Sequence martlvagvdtstqsckvrvtdaetgelvrfgqakhpngtsvdpsywwsafqeaaeqagglddvsalav ggqqhgmvildnqgnvirdamlwndtssapqaaalieklgaapaqdgepedpiargkqrwvkavgsspv asytltkvawvaenepenvkkiaaiclphdwlswriagygpvaegedahlealftdrsdasgtiyydaa sneyrrdliamvleaaegakaaqshaeaivlptvlgprdaapvkadpaiagknveggcllapgggdnam aslglgmavgdvsislgtsgvaaaisenptydltgavsgfadctghylplactingsrildagraalgv dydelaklafaskpgangitlvpyfdgertpnrpnatatfsgmtlanttrenlarafvegllcsqrdcl elirslgasitrilligggakseairtlapsilgmdvtrpatdeyvaigaarqaawvlsgeteppawql tidgvetgepteavyeayakarg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2260
    Matthews' coefficent 2.61 Rfactor 0.1805
    Waters 368 Solvent Content 52.84

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3i8b
    1. Crystal structure of a metal_dependent phosphoesterase (YP_910028. 1) from Bifidobacterium adolescentis: Computational prediction and experimental validation of
    GW Han, J Ko, CL Farr, MC Deller, Q Xu - Proteins: Structure, , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch