.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i9f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative type 11 methyltransferase from Sulfolobus solfataricus. To be Published
    Site NYSGXRC
    PDB Id 3i9f Target Id NYSGXRC-11118c
    Molecular Characteristics
    Source Sulfolobus solfataricus
    Alias Ids TPS31620,NP_342636.1, 3.40.50.150 Molecular Weight 20813.82 Da.
    Residues 176 Isoelectric Point 6.38
    Sequence mhhhrhyyppedfrrtferpeeylpnifegkkgvivdygcgngfyckyllefatklycidinvialkev kekfdsvitlsdpkeipdnsvdfilfansfhdmddkqhvisevkrilkddgrviiidwrkentgigppl sirmdekdymgwfsnfvvekrfnptpyhfglvlkrkts
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.257
    Matthews' coefficent 3.33 Rfactor 0.215
    Waters 31 Solvent Content 63.10

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 6

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch