.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ian

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a chitinase from Lactococcus lactis subsp. lactis. To be Published
    Site NYSGXRC
    PDB Id 3ian Target Id NYSGXRC-11091d
    Molecular Characteristics
    Source Lactococcus lactis subsp. lactis
    Alias Ids TPS31619,3.20.20.80, AAK06048.1 Molecular Weight 54518.09 Da.
    Residues 492 Isoelectric Point 5.32
    Sequence misvkkrreikvflvtasigivvlggqqvladaasemvnpkdkvlvgywhnwkstgkdgykggssadfn lsstqegynvinvsfmktpegqtlptfkpynktdtefraeisklnaegksvlialggadahielkksqe sdfvneiirlidtygfdgldidleqaaieaadnqtvipsalkkvkdhyrkdgknfmitmapefpyltss gkyapyinnldsyydfinpqyynqggdgfwdsdlnmwisqsndekkedflygltqrlvtgsdgfikipa skfviglpsnndaaatgyvkdpnavknalnrlkasgneikglmtwsvnwdagtnsngekynntfvntya pmlfnnqpiedtekptlptisisnvtastatiqgkstdnvridhyeikigtqsfkstsglqdvtglskk teynveivavdpsgnrsdtaratfmtldtsaenntwqkdkvyvqgdrvtfngvnyeakwwntgqlpdqs gdfgpwkkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.192
    Matthews' coefficent 3.04 Rfactor 0.169
    Waters 258 Solvent Content 59.52

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 10
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 3ian
    1. Human Chitotriosidase Catalyzed Hydrolysis of Chitosan
    KB Eide, AL Norberg, EB Heggset, AR Lindbom - Biochemistry, 2011 - ACS Publications
     
    2. Hallmarks of processivity in glycoside hydrolases from crystallographic and computational studies of the Serratia marcescens chitinases
    CM Payne, J Baban, SJ Horn, PH Backe - Journal of Biological , 2012 - ASBMB
     
    3. Processivity and substrate-binding in family 18 chitinases
    M Srlie, H Zakariassen, AL Norberg - Biocatalysis and , 2012 - informahealthcare.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch