.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ib6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein from Listeria monocytogenes serotype 4b. To be Published
    Site NYSGXRC
    PDB Id 3ib6 Target Id NYSGXRC-13913a
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS31563,CAD00787.1 Molecular Weight 20519.42 Da.
    Residues 181 Isoelectric Point 4.71
    Sequence lithviwdmgetlntvpntrydhypldtypevvlrkdaketlekvkqlgfkqailsntatsdtevikrv ltnfgiidyfdfiyasnselqpgkmekpdktifdftlnelqidkteavmvgntfesdiiganragihai wlqnpevclqderqplvappfvipvwdladvpeallllkkiss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.282
    Matthews' coefficent 2.15 Rfactor 0.218
    Waters 119 Solvent Content 42.81

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch