.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ibq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of pyridoxal kinase from Lactobacillus plantarum in complex with ATP. To be Published
    Site NYSGXRC
    PDB Id 3ibq Target Id NYSGXRC-11208c
    Related PDB Ids 3hyo 3h74 
    Molecular Characteristics
    Source Lactobacillus plantarum
    Alias Ids TPS27130,PF08543, 3.40.1190.20, NP_784595.1 Molecular Weight 28927.38 Da.
    Residues 272 Isoelectric Point 4.52
    Sequence lstmlvaedlsavggislssalpvltamqydvaalptsllsthtsgygtpavvdlstwlpqvfahwtra qlhfdqaligyvgsvalcqqittyleqqtlsllvvdpvlgdlgqlyqgfdqdyvaamrqliqqadvilp ntteaalltgapyqvtpdlevilpalqaqlktgahavitdvqradqigcawldeaghvqycgarrlpgh yngtgdtlaaviagllgrgyplaptlaranqwlnmavaetiaqnrtddrqgvalgdllqailaln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.21946
    Matthews' coefficent 2.44 Rfactor 0.17531
    Waters 169 Solvent Content 49.51

    Ligand Information
    Ligands ATP (ADENOSINE-5'-TRIPHOSPHATE) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch