.
The Open Protein Structure Annotation Network
PDB Keyword
.

3id9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a MutT/NUDIX family protein from Bacillus thuringiensis. To be Published
    Site NYSGXRC
    PDB Id 3id9 Target Id NYSGXRC-11181f
    Molecular Characteristics
    Source Bacillus thuringiensis
    Alias Ids TPS31642,3.90.79.10, YP_896013.1 Molecular Weight 18651.51 Da.
    Residues 162 Isoelectric Point 5.31
    Sequence vegfickfnrkrrlymenvmqvrvtgiliedekvllvkqkvanrnwslpggraengetleeamiremre etglevniqkllyvcdkpdarpsllhitflleriegeitlpsnefdhnpihdvqmipikdlsqydfset fislisegfvnagsyqglkrnigl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.55 Rfree 0.263
    Matthews' coefficent Rfactor 0.233
    Waters 123 Solvent Content

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch